DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1236 and CG31674

Sequence 1:NP_649579.2 Gene:CG1236 FlyBaseID:FBgn0037370 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001286111.1 Gene:CG31674 FlyBaseID:FBgn0051674 Length:327 Species:Drosophila melanogaster

Alignment Length:317 Identity:138/318 (43%)
Similarity:199/318 (63%) Gaps:1/318 (0%)


  Fly    28 KVYVTRPDVDDSGLELLRKSCQVSTWHETNPVPRSELIRVVAGKDALYCALTDKVDKEVLDAAGP 92
            ||.:...||...|:|:|::.|::.......|..|.|::..:.|..|:.....|.::.|:||||||
  Fly     8 KVLIAHTDVPPEGIEILKEQCEILQVINEPPKNRPEILEKIRGAHAVIWGGRDILNAEILDAAGP 72

  Fly    93 QLKCVATISVGYDHIDVEECRKRGIRVGFTPDVLTDATAELTLALLLATNRRLFEANKQVYNGGW 157
            |||.|:|:|.|.:::||.|.:||||.:|.||.:||.|.|:||:.||:|..||..|..:::.:..|
  Fly    73 QLKAVSTMSSGINNVDVPELKKRGIPLGSTPAMLTVAVADLTVGLLIAAARRFQEGRRKIDSDKW 137

  Fly   158 KSWAPMWMCGQGLKGSRVGLLGFGRIGQEIAARIVPFKPTEITYTTRSLRPKE-AAAVNARHVDF 221
            ......||.||.::.|.||..|||.|||.:|.|::.|....:.||||:...:: ....||:.|||
  Fly   138 DKDHLNWMLGQDIRDSTVGFYGFGGIGQAVAKRLMGFDIKRMLYTTRNRVSQDIEERFNAKKVDF 202

  Fly   222 DEMLRESDLIVVCCALTPETKEIFNATAFQKMKPNCILINTARGGVVDQKALYEALKTKRILAAG 286
            :.:|.|||.:::...||.||..:||||.|.|||...:|:|..||.:|:|..||||||:.||.|||
  Fly   203 ETLLAESDFLIIASPLTKETLGLFNATVFNKMKETAVLVNVGRGKIVNQDDLYEALKSNRIFAAG 267

  Fly   287 LDVTTPEPLPIDDPLLKLDNVVILPHIGSADIETRKEMSRITARNILAALAGDKMVA 343
            |||..|||||.:|.||.|||||:.||:|.|...||.:.:.:.:||:|..|||:.|::
  Fly   268 LDVMDPEPLPSNDKLLTLDNVVVTPHVGYATRRTRVDAANLASRNVLKGLAGEPMLS 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1236NP_649579.2 GDH 27..338 CDD:240626 136/311 (44%)
LdhA 27..338 CDD:223980 136/311 (44%)
CG31674NP_001286111.1 GDH 8..319 CDD:240626 136/311 (44%)
LdhA 9..321 CDD:223980 136/312 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65728464
eggNOG 1 0.900 E1_COG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1579
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1378766at2759
OrthoFinder 1 1.000 FOG0001099
orthoMCL 1 0.900 OOG5_126787
Panther 1 1.100 P PTHR10996
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1846
87.920

Return to query results.
Submit another query.