DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and YIR035C

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_012301.3 Gene:YIR035C SGDID:S000001474 Length:254 Species:Saccharomyces cerevisiae

Alignment Length:200 Identity:67/200 (34%)
Similarity:99/200 (50%) Gaps:29/200 (15%)


  Fly     7 KVIIVTGASSGIGAG-TSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPA-----------L 59
            |||:|||.|.|||.. ..||.            :|||  :|....||...||.           .
Yeast     3 KVILVTGVSRGIGKSIVDVLF------------SLDK--DTVVYGVARSEAPLKKLKEKYGDRFF 53

  Fly    60 QVAADINSESDVQGIVSATLAKHGRIDVLVNNAGILE-LGSIENTSLEQFDRVMNTNVRSLYQLT 123
            .|..||..:|.::.:|:|.:..||:||.||.|||:|| :.::....:..:.::.:.|..|:..|.
Yeast    54 YVVGDITEDSVLKQLVNAAVKGHGKIDSLVANAGVLEPVQNVNEIDVNAWKKLYDINFFSIVSLV 118

  Fly   124 HLVTPELIKTKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVI 188
            .:..|||.||.||:|.|||......|....||..||||::.|...:|.|  .:.|:..:|.||::
Yeast   119 GIALPELKKTNGNVVFVSSDACNMYFSSWGAYGSSKAALNHFAMTLANE--ERQVKAIAVAPGIV 181

  Fly   189 ITELQ 193
            .|::|
Yeast   182 DTDMQ 186

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 67/200 (34%)
NADB_Rossmann 4..254 CDD:304358 67/200 (34%)
YIR035CNP_012301.3 SPR-like_SDR_c 4..246 CDD:187625 66/199 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C105667819
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I1481
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T133844
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1710
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.