DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and OAR1

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_012868.1 Gene:OAR1 SGDID:S000001538 Length:278 Species:Saccharomyces cerevisiae

Alignment Length:267 Identity:65/268 (24%)
Similarity:110/268 (41%) Gaps:57/268 (21%)


  Fly     8 VIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETA--EQIVAAGGAPALQVAADINSE-- 68
            |.|||||:.|||......|.:.|....|:|...:.:..||  ...:.:|.:...|.|..|:.:  
Yeast     6 VAIVTGATRGIGKAICQKLFQKGLSCIILGSTKESIERTAIDRGQLQSGLSYQRQCAIAIDFKKW 70

  Fly    69 ------SDVQGI-----------VSATL----------AKHGRIDVLVNNAGILELGSIENTSLE 106
                  ....||           ..:||          .:...:::|:|.||:.:......|:..
Yeast    71 PHWLDYESYDGIEYFKDRPPLKQKYSTLFDPCNKWSNNERRYYVNLLINCAGLTQESLSVRTTAS 135

  Fly   107 QFDRVMNTNVRSLYQLTHLVTPELIKT------------KGNIVNVSSV--NGIRSFPGVLAYNV 157
            |...:||.|..|...:|::....::|:            :..|||:||:  :|....||...|:.
Yeast   136 QIQDIMNVNFMSPVTMTNICIKYMMKSQRRWPELSGQSARPTIVNISSILHSGKMKVPGTSVYSA 200

  Fly   158 SKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRRG-----GLDQEAYVKFLEHAKVTHALG 217
            ||||:.:||..:|.|:.|:.:|..:::||::      :|     .|..|| .:.||.........
Yeast   201 SKAALSRFTEVLAAEMEPRNIRCFTISPGLV------KGTDMIQNLPVEA-KEMLERTIGASGTS 258

  Fly   218 RPGEVKE 224
            .|.|:.|
Yeast   259 APAEIAE 265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 65/268 (24%)
NADB_Rossmann 4..254 CDD:304358 65/268 (24%)
OAR1NP_012868.1 SDR_c 7..275 CDD:212491 64/267 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000082
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1710
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.