DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and HSDL2

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_115679.2 Gene:HSDL2 HGNCID:18572 Length:418 Species:Homo sapiens

Alignment Length:244 Identity:68/245 (28%)
Similarity:109/245 (44%) Gaps:38/245 (16%)


  Fly     9 IIVTGASSGIGAGTSVLLAKLGGLLTIVGRN-------LDKLNETAEQIVAAGGAPALQVAADIN 66
            :.:||||.|||...::..||.|..:.|..:.       |..:...||:|.|.|| .||....|:.
Human    13 VFITGASRGIGKAIALKAAKDGANIVIAAKTAQPHPKLLGTIYTAAEEIEAVGG-KALPCIVDVR 76

  Fly    67 SESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELI 131
            .|..:...|...:.|.|.||:|||||..:.|.:..:|..::.|.:||.|.|..|..:....|.|.
Human    77 DEQQISAAVEKAIKKFGGIDILVNNASAISLTNTLDTPTKRLDLMMNVNTRGTYLASKACIPYLK 141

  Fly   132 KTK-GNIVNVS---SVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKG-VRVNSVNPGVIITE 191
            |:| .:|:|:|   ::|.: .|....||.::|..:..:...:|.|.  || :.||::.|...|  
Human   142 KSKVAHILNISPPLNLNPV-WFKQHCAYTIAKYGMSMYVLGMAEEF--KGEIAVNALWPKTAI-- 201

  Fly   192 LQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFS 240
                             |......||.|| ::.....:..:|  :|::|
Human   202 -----------------HTAAMDMLGGPG-IESQCRKVDIIA--DAAYS 230

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 68/245 (28%)
NADB_Rossmann 4..254 CDD:304358 68/245 (28%)
HSDL2NP_115679.2 HSDL2_SDR_c 8..248 CDD:187663 68/245 (28%)
SCP2 319..412 CDD:307934
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.