DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and AT1G24360

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_564216.1 Gene:AT1G24360 AraportID:AT1G24360 Length:319 Species:Arabidopsis thaliana

Alignment Length:246 Identity:87/247 (35%)
Similarity:128/247 (52%) Gaps:10/247 (4%)


  Fly     8 VIIVTGASSGIGAGTSVLLAKLG-GLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSESDV 71
            |:::||||.|||...::.|.|.| .:|....|:..:..|.|:||...|| .|:....|::..:||
plant    78 VVVITGASRGIGKAIALALGKAGCKVLVNYARSAKEAEEVAKQIEEYGG-QAITFGGDVSKATDV 141

  Fly    72 QGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIKTK-G 135
            ..::...|.|.|.|||:||||||.....:......|:|.|:..|:..::..|......::|.| |
plant   142 DAMMKTALDKWGTIDVVVNNAGITRDTLLIRMKQSQWDEVIALNLTGVFLCTQAAVKIMMKKKRG 206

  Fly   136 NIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRRGGLDQ 200
            .|:|:|||.|:....|...|..:|..|..|::..|.|.|.:.:.||.|.||.|.:::....|.|.
plant   207 RIINISSVVGLIGNIGQANYAAAKGGVISFSKTAAREGASRNINVNVVCPGFIASDMTAELGEDM 271

  Fly   201 EAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLA-SDEASFSTGISLPVDGG 250
            |.  |.|.    |..|||.|:.:|||..:.||| |..||:.||.:..:|||
plant   272 EK--KILG----TIPLGRYGKAEEVAGLVEFLALSPAASYITGQAFTIDGG 316

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 87/247 (35%)
NADB_Rossmann 4..254 CDD:304358 87/247 (35%)
AT1G24360NP_564216.1 BKR_SDR_c 78..316 CDD:187594 86/245 (35%)
3oxo_ACP_reduc 79..318 CDD:273824 86/246 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126618
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.