DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and AT5G18210

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_197322.2 Gene:AT5G18210 AraportID:AT5G18210 Length:277 Species:Arabidopsis thaliana

Alignment Length:249 Identity:84/250 (34%)
Similarity:126/250 (50%) Gaps:28/250 (11%)


  Fly     3 SFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVA-----AGGAP---AL 59
            |...:|.||||:|.|||...::.||:||..:.|   |....:..|:|:.|     ||..|   |:
plant     7 SLAGRVAIVTGSSRGIGRAIAIHLAELGAKIVI---NYTTRSTEADQVAAEINSSAGTVPQPIAV 68

  Fly    60 QVAADINSESDVQGIV-SATLAKHGRIDVLVNNAGIL--ELGSIENTSLEQFDRVMNTNVRSLYQ 121
            ...|||:..|.::.:. :|..|.:..:.:|||:||||  ...:|.||.:|:|||:...|.|..: 
plant    69 VFLADISEPSQIKSLFDAAEKAFNSPVHILVNSAGILNPNYPTIANTPIEEFDRIFKVNTRGSF- 132

  Fly   122 LTHLVTPELIKT-----KGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVN 181
               |...|..|.     .|.|:.::|.......||..||..|||||:...:.:|.||...|:..|
plant   133 ---LCCKEAAKRLKRGGGGRIILLTSSLTEALIPGQGAYTASKAAVEAMVKILAKELKGLGITAN 194

  Fly   182 SVNPGVIITELQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASD 235
            .|:||.:.||: ...|..:|..:..:|.:    ..||.||.|::|:.:.|||||
plant   195 CVSPGPVATEM-FFDGKSEETVMNIIERS----PFGRLGETKDIASVVGFLASD 243

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 84/250 (34%)
NADB_Rossmann 4..254 CDD:304358 83/249 (33%)
AT5G18210NP_197322.2 fabG 7..245 CDD:235500 84/250 (34%)
NADB_Rossmann 8..245 CDD:304358 83/249 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D913128at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
22.020

Return to query results.
Submit another query.