DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and AT3G55290

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_567019.1 Gene:AT3G55290 AraportID:AT3G55290 Length:280 Species:Arabidopsis thaliana

Alignment Length:260 Identity:86/261 (33%)
Similarity:145/261 (56%) Gaps:24/261 (9%)


  Fly     5 KDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQI--VAAGGAPALQVAADINS 67
            ||||::|||||||||....:.|||.|..:....|.:|:||....:|  .::.|..|..:..|::|
plant    19 KDKVVLVTGASSGIGREICLDLAKAGCQVIAAARRVDRLNSLCSEINSFSSTGIQAAALELDVSS 83

  Fly    68 E-SDVQGIVSATLAKHGRIDVLVNNAGILELGSIENT---SLEQFDRVMNTNVRSLYQLTHLVTP 128
            : :.:|..|.......|:||.|:|||||  .|:::::   |.:::|.|..||::..:.::..|..
plant    84 DAATIQKAVREAWDIFGKIDALINNAGI--RGNVKSSLDLSEDEWDNVFKTNLKGPWLVSKHVCM 146

  Fly   129 EL--IKTKGNIVNVSSVNGIRS-FPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIIT 190
            .:  .|..|:::|:||:.|||. .||.|||..||..||..:|.:||||....:||||:.||:..:
plant   147 LMRDAKRGGSVINISSIAGIRGMLPGGLAYACSKGGVDTMSRMMALELGVHKIRVNSIAPGLFKS 211

  Fly   191 ELQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKE-----VAAAIAFLASDEASFSTGISLPVDGG 250
            |:.:  ||.|:.::|.:....|      |.:|::     :.:.:.:|..|.:.:.:|.:..||.|
plant   212 EITQ--GLMQKEWLKNVTERTV------PLKVQQTVDPGLTSLVRYLIHDSSQYISGNTYIVDSG 268

  Fly   251  250
            plant   269  268

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 86/261 (33%)
NADB_Rossmann 4..254 CDD:304358 86/261 (33%)
AT3G55290NP_567019.1 fabG 18..271 CDD:235546 86/261 (33%)
SDR_c 23..266 CDD:212491 80/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I1891
OMA 1 1.010
OrthoDB 1 1.010 D913128at2759
OrthoInspector 1 1.000 T32234
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
44.070

Return to query results.
Submit another query.