DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and SDR2

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_190736.1 Gene:SDR2 AraportID:AT3G51680 Length:303 Species:Arabidopsis thaliana

Alignment Length:266 Identity:86/267 (32%)
Similarity:142/267 (53%) Gaps:29/267 (11%)


  Fly     7 KVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKL--NETAEQIVAAGGAPALQ-VAADINSE 68
            ||.|:||.:.|||..|.:|.|:.|.  |:|..::|.:  :..|:.:.:...:|.:. ::.|::.|
plant    35 KVAIITGGAHGIGKATVMLFARHGA--TVVIADVDNVAGSSLAKSLSSHKTSPMVAFISCDVSVE 97

  Fly    69 SDVQGIVSATLAKHGRIDVLVNNAGIL----ELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPE 129
            :||:.:|:.|:|::||:|:|.||||:|    :..||.:...::||.||..|||.:..........
plant    98 ADVENLVNVTVARYGRLDILFNNAGVLGDQKKHKSILDFDADEFDHVMRVNVRGVGLGMKHGARA 162

  Fly   130 LIKT--KGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITEL 192
            :||.  ||.|::.:||.|:....|..||..||.|:...|:..|.||...|:|||.::|..:.|.:
plant   163 MIKRGFKGCIISTASVAGVMGGMGPHAYTASKHAIVGLTKNAACELGKYGIRVNCISPFGVATSM 227

  Fly   193 ------QRRGG-------LDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGIS 244
                  :..||       .:.|.:|:.|.:.|     |......::|.|..:|||||:.:..|.:
plant   228 LVNAWRKTSGGDVEDDDVEEMEEFVRSLANLK-----GETLRANDIAEAALYLASDESKYVNGHN 287

  Fly   245 LPVDGG 250
            |.||||
plant   288 LVVDGG 293

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 86/267 (32%)
NADB_Rossmann 4..254 CDD:304358 86/267 (32%)
SDR2NP_190736.1 PLN02253 23..296 CDD:177895 86/267 (32%)
NADB_Rossmann 31..295 CDD:304358 86/267 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T32102
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.