DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and AT3G46170

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_190203.1 Gene:AT3G46170 AraportID:AT3G46170 Length:288 Species:Arabidopsis thaliana

Alignment Length:258 Identity:86/259 (33%)
Similarity:142/259 (55%) Gaps:20/259 (8%)


  Fly     5 KDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAG--GAPALQVAADINS 67
            ||||::|||||||||....:.|.|.|..:..|.|.:|:||....:|.::.  |..|..:..|:.|
plant    27 KDKVVLVTGASSGIGREICLDLGKAGCKIIAVARRVDRLNSLCSEINSSSSTGIQAAALKLDVTS 91

  Fly    68 E-SDVQGIVSATLAKHGRIDVLVNNAGILELGSIENT---SLEQFDRVMNTNVRSLYQLTHLVTP 128
            : :.:|.:|.......|:||.|:|||||  .|:::::   |.|::|.|..||:...:.::..|..
plant    92 DAATIQKVVQGAWGIFGKIDALINNAGI--RGNVKSSLDLSKEEWDNVFKTNLTGPWLVSKYVCV 154

  Fly   129 EL--IKTKGNIVNVSSVNGIRS-FPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIIT 190
            .:  .|..|:::|:||:.|||. .||.|||..||..||..::.:|:||....:||||:.||:..:
plant   155 LMRDAKLGGSVINISSIAGIRGILPGALAYACSKIGVDTMSKMMAVELGVHKIRVNSIAPGIFKS 219

  Fly   191 ELQRRGGLDQEAYVKFLEHAKVTHALGR---PGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
            |:.:  ||.|:.:.|.:....|...|.:   ||    :.:.:.:|..|.:.:.:|.:..||.|
plant   220 EITQ--GLMQKEWFKNVTERTVPLKLQQTVDPG----ITSLVRYLIHDSSQYISGNTYIVDSG 276

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 86/259 (33%)
NADB_Rossmann 4..254 CDD:304358 86/259 (33%)
AT3G46170NP_190203.1 fabG 26..279 CDD:235546 86/259 (33%)
SDR_c 31..274 CDD:212491 80/251 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I1891
OMA 1 1.010
OrthoDB 1 1.010 D913128at2759
OrthoInspector 1 1.000 T32234
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
44.070

Return to query results.
Submit another query.