DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and ATA1

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_189882.1 Gene:ATA1 AraportID:AT3G42960 Length:272 Species:Arabidopsis thaliana

Alignment Length:263 Identity:94/264 (36%)
Similarity:139/264 (53%) Gaps:31/264 (12%)


  Fly     6 DKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSESD 70
            :||.|:||.:.||||.|:.|..: .|...||...|:.     |.|:.|.......|..|::.|:|
plant    10 EKVAIITGGARGIGAATARLFTE-NGAYVIVADILEN-----EGILVAESIGGCYVHCDVSKEAD 68

  Fly    71 VQGIVSATLAKHGRIDVLVNNAGI-LELGSIENTSLEQFDRVMNTNVRS-LYQLTHLVTPELIK- 132
            |:..|...:.:.||:||:.||||: |..|||....::..:::::.||.. |:.:.| ....:|| 
plant    69 VEAAVELAMRRKGRLDVMFNNAGMSLNEGSIMGMDVDMVNKLVSVNVNGVLHGIKH-AAKAMIKG 132

  Fly   133 -TKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRRG 196
             ..|:|:..||.:|:....|..||.:||.|::...|..|.||...|:||||::|..:.|::.   
plant   133 GRGGSIICTSSSSGLMGGLGGHAYTLSKGAINGVVRTTACELGSHGIRVNSISPHGVPTDIL--- 194

  Fly   197 GLDQEAYVKFLEH-----AKVTHAL--------GRPGEVKEVAAAIAFLASDEAS-FSTGISLPV 247
               ..||.|||.|     |:||..:        ||.|.|::||.|..||||.|:| |.||.:|.|
plant   195 ---VNAYRKFLNHDKLNVAEVTDIIAEKGSLLTGRAGTVEDVAQAALFLASQESSGFITGHNLVV 256

  Fly   248 DGG 250
            |||
plant   257 DGG 259

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 94/264 (36%)
NADB_Rossmann 4..254 CDD:304358 94/264 (36%)
ATA1NP_189882.1 PLN02253 4..268 CDD:177895 94/264 (36%)
NADB_Rossmann 7..261 CDD:304358 94/264 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T32102
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.