DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and AT3G29260

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_189571.1 Gene:AT3G29260 AraportID:AT3G29260 Length:259 Species:Arabidopsis thaliana

Alignment Length:250 Identity:89/250 (36%)
Similarity:126/250 (50%) Gaps:14/250 (6%)


  Fly     7 KVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQI-VAAGGAPALQVAADINSESD 70
            |::|:||.:|||||..:.|....|..:.||    |...|..:.: |:.|...|.....||..|::
plant     9 KIVIITGGASGIGAEAARLFTDHGAKVVIV----DLQEELGQNVAVSIGLDKASFYRCDITDETE 69

  Fly    71 VQGIVSATLAKHGRIDVLVNNAGILE-LGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIK-- 132
            |:..|..|:.|||::|||.:|||::| .|||.:..||.|||.|..|||............::.  
plant    70 VENAVKFTVEKHGKLDVLFSNAGVMEPHGSILDLDLEAFDRTMAVNVRGAAAFIKHAARSMVASG 134

  Fly   133 TKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRRGG 197
            |:|:||..:||......||..:|..||.|:....|.....|...|:|||.|.|..:.|.|...  
plant   135 TRGSIVCTTSVTAEIGGPGPHSYTASKHALLGLVRSACGGLGKYGIRVNGVAPYGVATGLTSY-- 197

  Fly   198 LDQEAYVKFLE-HAKVTHAL-GRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
              .|..||.:| :...|..| |...:.:.||.|..|||||::.:.:|.:|.||||
plant   198 --NEETVKMVEDYCSATAILKGVVLKARHVADAALFLASDDSVYISGQNLGVDGG 250

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 89/250 (36%)
NADB_Rossmann 4..254 CDD:304358 89/250 (36%)
AT3G29260NP_189571.1 PLN02253 1..254 CDD:177895 89/250 (36%)
NADB_Rossmann 5..252 CDD:304358 89/250 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T32102
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.