DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and SDR5

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_566097.1 Gene:SDR5 AraportID:AT2G47140 Length:257 Species:Arabidopsis thaliana

Alignment Length:262 Identity:79/263 (30%)
Similarity:126/263 (48%) Gaps:25/263 (10%)


  Fly     7 KVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQI-VAAGGAPALQVAADINSESD 70
            |::|:||.:|||||.:..|..:.|..:.||    |..:|..:.: |:.|...|.....|:.:|::
plant     9 KIVIITGGASGIGAESVRLFTEHGARVVIV----DVQDELGQNVAVSIGEDKASYYHCDVTNETE 69

  Fly    71 VQGIVSATLAKHGRIDVLVNNAGILE-LGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIK-- 132
            |:..|..|:.|:|::|||.:|||::| ..||.:.:|.:.||.:..|:|.        |...||  
plant    70 VENAVKFTVEKYGKLDVLFSNAGVIEPFVSILDLNLNELDRTIAINLRG--------TAAFIKHA 126

  Fly   133 --------TKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVII 189
                    .:|:||..:||....:......|..||..:....:..:..|...|:|||.|.|..:.
plant   127 ARAMVEKGIRGSIVCTTSVAAEIAGTAPHGYTTSKHGLLGLIKSASGGLGKYGIRVNGVAPFGVA 191

  Fly   190 TELQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGGRHAM 254
            |.|. ..|...|..|.....:...:..|...:.:.||.|..||||||:::.:|.:|.||||...:
plant   192 TPLV-CNGFKMEPNVVEQNTSASANLKGIVLKARHVAEAALFLASDESAYVSGQNLAVDGGYSVV 255

  Fly   255 CP 256
            .|
plant   256 KP 257

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 78/256 (30%)
NADB_Rossmann 4..254 CDD:304358 78/259 (30%)
SDR5NP_566097.1 PLN02253 1..255 CDD:177895 78/259 (30%)
NADB_Rossmann 5..253 CDD:304358 78/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D913128at2759
OrthoInspector 1 1.000 T32102
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.