DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and AT2G47120

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001325398.1 Gene:AT2G47120 AraportID:AT2G47120 Length:259 Species:Arabidopsis thaliana

Alignment Length:263 Identity:83/264 (31%)
Similarity:127/264 (48%) Gaps:29/264 (11%)


  Fly     7 KVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQI-VAAGGAPALQVAADINSESD 70
            |::|:||.:|||||..:.|....|..:.||    |...|..:.: |..|...|.....|:.:|::
plant    10 KIVIITGGASGIGADAARLFTDHGAKVVIV----DVQEELGQNVAVLIGKDKASFYRCDVTNETE 70

  Fly    71 VQGIVSATLAKHGRIDVLVNNAGILE-LGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIK-- 132
            |:..|..|:.|||::|||.:|||:|| |.|..:..||:|||:|..|||............:::  
plant    71 VEDAVKFTVEKHGKLDVLFSNAGVLEPLESFLDFDLERFDRIMAVNVRGAAAFIKHAARAMVEKG 135

  Fly   133 TKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITEL----- 192
            |:|:||..:||:. ....|...|..||..:....|....:|...|:|||.|.|..:.|.:     
plant   136 TRGSIVCTTSVSA-EIGGGHHGYTASKHGLVGLIRSACGDLGKYGIRVNGVAPYAVATPMTSHDE 199

  Fly   193 ----QRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGGRHA 253
                |.....|.:..:|.:. .|.:|          ||....|||||::::.:|.:|.||||...
plant   200 VTGKQLEDYFDAKGILKGMV-LKASH----------VAQVALFLASDDSAYISGQNLAVDGGYTV 253

  Fly   254 MCP 256
            :.|
plant   254 VKP 256

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 82/257 (32%)
NADB_Rossmann 4..254 CDD:304358 82/260 (32%)
AT2G47120NP_001325398.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T32102
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.