DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and SAG13

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_180496.1 Gene:SAG13 AraportID:AT2G29350 Length:269 Species:Arabidopsis thaliana

Alignment Length:244 Identity:82/245 (33%)
Similarity:119/245 (49%) Gaps:10/245 (4%)


  Fly    10 IVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINS-ESDVQG 73
            :|||.|.|||......||.||..:....|:..:|.|...:..|.|......| .|::| :..|:.
plant    21 LVTGGSKGIGEAVVEELAMLGAKVHTCARDETQLQERLREWQAKGFQVTTSV-CDVSSRDQRVKL 84

  Fly    74 IVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIKT--KGN 136
            :.:.:....|::::||||.|..........:.|.|..||.||:.|.:.|:.|..| |:|.  .|:
plant    85 METVSSLYQGKLNILVNNVGTSIFKPTTEYTAEDFSFVMATNLESAFHLSQLAHP-LLKASGSGS 148

  Fly   137 IVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRRGGLDQE 201
            ||.:||..|:........|..:|.|::|..|.:|.|.|...:|.|||.|..|.|.|. ....|:|
plant   149 IVLISSAAGVVHVNVGSIYGATKGAMNQLARNLACEWASDNIRTNSVCPWYITTPLS-NDFFDEE 212

  Fly   202 AYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
                |.:.|..|..:||.||..||:..:|||....||:.||.::.||||
plant   213 ----FKKEAVRTTPMGRVGEANEVSPLVAFLCLPSASYITGQTICVDGG 257

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 82/245 (33%)
NADB_Rossmann 4..254 CDD:304358 82/245 (33%)
SAG13NP_180496.1 PRK09242 11..263 CDD:181721 82/245 (33%)
NADB_Rossmann 12..261 CDD:304358 82/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T32206
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.