DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and TRI

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_180494.1 Gene:TRI AraportID:AT2G29330 Length:260 Species:Arabidopsis thaliana

Alignment Length:260 Identity:83/261 (32%)
Similarity:126/261 (48%) Gaps:27/261 (10%)


  Fly     3 SFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVA---AD 64
            |.:....:|||.:||||......||..|..:.:...:...||::..:....|    .||:   .|
plant     6 SLQGLTALVTGGASGIGHAIVEELAGFGAKIHVCDISKTLLNQSLSEWEKKG----FQVSGSVCD 66

  Fly    65 INSESDVQGIV-SATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTP 128
            .::..:.:.:: :.|....|::::||||.|.:..........|.|..:::||:.|.|.|:.|..|
plant    67 ASNRLERETLMQTVTTIFDGKLNILVNNVGTIRTKPTIEYEAEDFSFLISTNLESAYHLSQLSHP 131

  Fly   129 ELIKTKGN--IVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITE 191
             |:|..||  |..:||..||.||.....|.::|.|::|..|.:|.|.|..|:|.|:|.|..|.|.
plant   132 -LLKASGNGIITFISSAAGIVSFDAASIYGLTKGALNQLARNLACEWAKDGIRANAVAPNFITTA 195

  Fly   192 LQRRGGLDQEAYVKFLEHAKVTH------ALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
            |.:          .|||.|....      .|||.||.:|||:.:|||....||:.||.::.||||
plant   196 LAK----------PFLEDAGFNEILSSRTPLGRAGEPREVASLVAFLCLPAASYITGQTICVDGG 250

  Fly   251  250
            plant   251  250

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 83/261 (32%)
NADB_Rossmann 4..254 CDD:304358 82/260 (32%)
TRINP_180494.1 PRK09242 1..256 CDD:181721 83/261 (32%)
NADB_Rossmann 4..254 CDD:304358 83/261 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T32206
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.