DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and AT2G29320

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_180493.1 Gene:AT2G29320 AraportID:AT2G29320 Length:269 Species:Arabidopsis thaliana

Alignment Length:263 Identity:80/264 (30%)
Similarity:126/264 (48%) Gaps:32/264 (12%)


  Fly     3 SFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVA---AD 64
            |.:....:||||:||||......||..|..:.|...:...||::..:....|    .||:   .|
plant    12 SLQGMTALVTGAASGIGYAIVEELAGFGAKIHICDISKTLLNQSLSEWENKG----FQVSGSVCD 72

  Fly    65 INSESDVQGIVSATLAK--HGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVT 127
            :.|..:.:.::. |::.  .|::::||||.|:|..........:.|...::||:.:.|....|..
plant    73 VTSHPEREKLMQ-TVSSIFDGKLNILVNNVGVLRGKPTTEYVADDFTFHISTNLEAAYHFCQLSH 136

  Fly   128 PELIKTK--GNIVNVSSVNGIRSF--PGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVI 188
            | |:|..  |:||.:|||.|:.|.  .|.: |.::|.|::|..|.:|.|.|..|:|.|:|.|.|:
plant   137 P-LLKASGYGSIVFLSSVAGVVSLIDCGSI-YGLTKGALNQLARNLACEWAKDGIRANAVAPNVV 199

  Fly   189 ITELQRRGGLDQEAYVKFLEHAKVTHA------LGRPGEVKEVAAAIAFLASDEASFSTGISLPV 247
            .|...:          .|||.......      |||.||..||::.:.||....||:.||.::.|
plant   200 KTAQSQ----------SFLEDVSKKEGLLSRTPLGRVGEPNEVSSLVVFLCLPAASYITGQTICV 254

  Fly   248 DGG 250
            |||
plant   255 DGG 257

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 80/264 (30%)
NADB_Rossmann 4..254 CDD:304358 79/263 (30%)
AT2G29320NP_180493.1 PRK09242 10..263 CDD:181721 80/264 (30%)
NADB_Rossmann 11..261 CDD:304358 80/264 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T32206
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.