DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and AT2G29290

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001118408.1 Gene:AT2G29290 AraportID:AT2G29290 Length:262 Species:Arabidopsis thaliana

Alignment Length:249 Identity:75/250 (30%)
Similarity:117/250 (47%) Gaps:19/250 (8%)


  Fly    10 IVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADI------NSE 68
            :|||.:.|||......|:.||..:....|:..:|.|...:....|    .||...|      ...
plant    13 LVTGGTKGIGEAVVEELSILGARVHTCARDETQLQERLREWQEKG----FQVTTSICDVSLREQR 73

  Fly    69 SDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIKT 133
            ..:...||:..  .|::::||||.|.|.|......:.|:|..:|.||:.|.:.::.|..| |:|.
plant    74 EKLMETVSSLF--QGKLNILVNNVGTLMLKPTTEYTAEEFSFLMATNLDSAFHISQLAHP-LLKA 135

  Fly   134 --KGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRRG 196
              .|:||.:||:.|:........|..:|.|::|..|.:|.|.|...:|.|::.|.:|.|.|..  
plant   136 SGSGSIVLMSSIAGVVHVGVGSIYGATKGAMNQLARNLACEWASDNIRTNAICPWLITTPLIS-- 198

  Fly   197 GLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
              |..:..:..:.|:....:||.||..||:..:|||....||:.||..:.||||
plant   199 --DLLSVEEMKKEAEERTPMGRVGEANEVSPLVAFLCLPAASYITGQVICVDGG 250

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 75/250 (30%)
NADB_Rossmann 4..254 CDD:304358 75/250 (30%)
AT2G29290NP_001118408.1 PRK09242 1..256 CDD:181721 75/250 (30%)
NADB_Rossmann 4..254 CDD:304358 75/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T32206
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.