DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and F12E12.12

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001129811.1 Gene:F12E12.12 WormBaseID:WBGene00086558 Length:215 Species:Caenorhabditis elegans

Alignment Length:257 Identity:80/258 (31%)
Similarity:115/258 (45%) Gaps:68/258 (26%)


  Fly     1 MPSFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPA---LQVA 62
            |..|..||.:|||:|:|||...::|.|:.|..:||.|||.::|.|| .|.:...|.||   |.:|
 Worm     1 MARFSGKVALVTGSSNGIGRAAALLFAQQGAKVTITGRNAERLEET-RQAILKSGVPAENVLAIA 64

  Fly    63 ADINSESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVT 127
            .|:.::             .|:.| |:|                                     
 Worm    65 TDLATD-------------QGQTD-LIN------------------------------------- 78

  Fly   128 PELIKTKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITEL 192
                   |.:.|:.:  |..:.|.::.|.:||||:|||||..|:.|...|||||||:|||:.|.:
 Worm    79 -------GTLQNIGA--GPHAHPDMMYYGMSKAALDQFTRSTAITLIQHGVRVNSVSPGVVYTGI 134

  Fly   193 QRRGGLDQEAY---VKFLEHAKVTHALGRPGEVKEVAAAIAFLAS-DEASFSTGISLPVDGG 250
            ....|....|:   :||.|..|.....|...:..|:|..|||||. ..:|:..|.|:..|||
 Worm   135 GEAMGFPPGAFEKTMKFYESHKECVPCGHMAQPVEIAQVIAFLADRTMSSYIIGQSIIADGG 196

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 79/257 (31%)
NADB_Rossmann 4..254 CDD:304358 79/255 (31%)
F12E12.12NP_001129811.1 FabG 3..196 CDD:223959 78/254 (31%)
NADB_Rossmann 4..200 CDD:304358 79/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D487970at33208
OrthoFinder 1 1.000 FOG0000082
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.