DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and Dhrs2

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_001078405.4 Gene:Dhrs2 RGDID:1583909 Length:289 Species:Rattus norvegicus

Alignment Length:245 Identity:80/246 (33%)
Similarity:121/246 (49%) Gaps:7/246 (3%)


  Fly     7 KVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSESDV 71
            ||.:|||::.|||...:..:|:.|..:.|..|..:.:.| |..|:...|.........:....|.
  Rat    45 KVAVVTGSTRGIGFAIARRMARDGAHVVISSRKQENVKE-AVDILKEEGLSVTGTVCHVGKAEDR 108

  Fly    72 QGIVSATLAKHGRIDVLVNNAGILEL-GSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIKTKG 135
            |.:|:..|...|.||.||..||:..| ||....|.:.:|::::.||:|...|...|.|.:....|
  Rat   109 QHLVTTALKHSGGIDFLVCVAGVNPLVGSTLAASEQIWDKILDVNVKSPALLLSQVLPHMENRGG 173

  Fly   136 N-IVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRRGGLD 199
            . :|.|||.......|.:..||.||.|:....:.:|:||||||:|||.:.||:|.|:...|    
  Rat   174 GCVVLVSSAVAYLPVPRLGVYNTSKTALLGLCKSLAVELAPKGIRVNCLAPGIIKTDFSLR---- 234

  Fly   200 QEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDG 249
            :|.....|...|....:.|.||.:|.|..::||.|.:.|:.||.::.|.|
  Rat   235 EETMPNMLPELKKVFGVQRLGEPEECAGLVSFLCSSDGSYITGENIVVGG 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 80/246 (33%)
NADB_Rossmann 4..254 CDD:304358 80/246 (33%)
Dhrs2XP_001078405.4 NADB_Rossmann 42..287 CDD:304358 80/246 (33%)
fabG 42..284 CDD:235975 79/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110214133
eggNOG 1 0.900 E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000082
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.