DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and Hsd17b14

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001178040.1 Gene:Hsd17b14 RGDID:1588673 Length:270 Species:Rattus norvegicus

Alignment Length:261 Identity:92/262 (35%)
Similarity:131/262 (50%) Gaps:33/262 (13%)


  Fly     4 FKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIV-----AAGGAPALQ--- 60
            :..||::|||.|.||||             .||...:|    :..|:|     .|||....|   
  Rat     7 YSGKVVVVTGGSRGIGA-------------AIVRAFVD----SGAQVVFCDKDEAGGRAVEQELL 54

  Fly    61 ----VAADINSESDVQGIVSATLAKHGRIDVLVNNAGILELGSI-ENTSLEQFDRVMNTNVRSLY 120
                :..|:..|.|:|.::|.|:::.|.:|.:|||||......: |.||.:.|.:::..|:...|
  Rat    55 GTVFIPGDVTQEGDLQTLISETVSRFGHLDCVVNNAGYHPPAQLPEETSAQGFRQLLEENLLGAY 119

  Fly   121 QLTHLVTPELIKTKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNP 185
            .|..|..|.|.|:||||:|:||:.|.......|.|..:|.||...|:.:||:.:..|||||.::|
  Rat   120 TLIKLALPHLRKSKGNIINISSLVGAIGQSQALTYVATKGAVTAMTKALALDESRYGVRVNCISP 184

  Fly   186 GVIITEL-QRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDG 249
            |.|.|.| |.......:.....|| ..:...|||.|:..||.||..|||| ||:|.||:.|.:.|
  Rat   185 GNIWTPLWQELAAATSDPRATILE-GTLAQPLGRMGQPAEVGAAAVFLAS-EATFCTGLELFMTG 247

  Fly   250 G 250
            |
  Rat   248 G 248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 92/262 (35%)
NADB_Rossmann 4..254 CDD:304358 92/262 (35%)
Hsd17b14NP_001178040.1 NADB_Rossmann 1..256 CDD:304358 92/262 (35%)
fabG 8..251 CDD:235546 92/261 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4318
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D487970at33208
OrthoFinder 1 1.000 FOG0000082
OrthoInspector 1 1.000 T618282
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.