DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and Decr2

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_741993.1 Gene:Decr2 RGDID:71002 Length:292 Species:Rattus norvegicus

Alignment Length:255 Identity:83/256 (32%)
Similarity:133/256 (52%) Gaps:8/256 (3%)


  Fly     5 KDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSES 69
            :|||..:||..||||...:.:..:.|....||.|:|.:::|.|:::|||.|...|.::.|:....
  Rat    27 QDKVAFITGGGSGIGFRIAEIFMRHGCHTVIVSRSLPRVSEAAKKLVAATGKRCLPLSMDVRVPP 91

  Fly    70 DVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIKTK 134
            .|...|...|.:.|:||:|:|.|....|......|...|..|::.:....:.::.::..:..:..
  Rat    92 AVMAAVDQALKEFGKIDILINCAAGNFLCPASALSFNAFKTVVDIDTLGTFNVSRVLYEKFFRDH 156

  Fly   135 GN-IVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVII-TE-LQRRG 196
            |. |||:::...:|.....|....:|||||..||.:|:|..|:.:||||:.||.|. || |:|.|
  Rat   157 GGVIVNITATLSMRGQVLQLHAGAAKAAVDAMTRHLAVEWGPQNIRVNSLAPGAISGTEGLRRLG 221

  Fly   197 GLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGGRHAMCP 256
            |....:..|:|     :..:.|.|...|:|.::.:|||..||:.:||.|.||||.....|
  Rat   222 GPKASSKFKYL-----SSPIPRLGTKTEIAHSVLYLASPLASYVSGIVLVVDGGSWMTLP 276

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 82/249 (33%)
NADB_Rossmann 4..254 CDD:304358 82/252 (33%)
Decr2NP_741993.1 TER_DECR_SDR_a 26..273 CDD:187627 82/251 (33%)
PRK07576 26..271 CDD:236056 82/249 (33%)
Substrate binding. {ECO:0000250} 126..128 1/2 (50%)
Microbody targeting signal 290..292
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.