DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and BDH2

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_006714337.1 Gene:BDH2 HGNCID:32389 Length:259 Species:Homo sapiens

Alignment Length:269 Identity:83/270 (31%)
Similarity:128/270 (47%) Gaps:44/270 (16%)


  Fly     7 KVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQV-AADINSESD 70
            ||||:|.|:.|||...::..|:.|..:.....|..||.|..:.       |.:|. ..|:..:..
Human     7 KVIILTAAAQGIGQAAALAFAREGAKVIATDINESKLQELEKY-------PGIQTRVLDVTKKKQ 64

  Fly    71 VQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIKTK- 134
            :....:..    .|:|||.|.||.:..|::.:...:.:|..||.||||:|.:.....|:::..| 
Human    65 IDQFANEV----ERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKS 125

  Fly   135 GNIVNVSSVNGIRSFPGVLA------------------YNVSKAAVDQFTRCVALELAPKGVRVN 181
            |||:|:|||   .|...|:|                  |:.:||||...|:.||.:...:|:|.|
Human   126 GNIINMSSV---ASSVKVMATDDEKLRLPMLRVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCN 187

  Fly   182 SVNPGVIIT-----ELQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFST 241
            .|.||.:.|     .:|.||. .:||...||:..|.    ||....:|:|....:|||||:::.|
Human   188 CVCPGTVDTPSLQERIQARGN-PEEARNDFLKRQKT----GRFATAEEIAMLCVYLASDESAYVT 247

  Fly   242 GISLPVDGG 250
            |..:.:|||
Human   248 GNPVIIDGG 256

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 83/270 (31%)
NADB_Rossmann 4..254 CDD:304358 83/270 (31%)
BDH2XP_006714337.1 PRK06138 2..258 CDD:235712 83/270 (31%)
DHRS6_like_SDR_c 5..259 CDD:187626 83/270 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1710
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.