DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and PECR

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_060911.2 Gene:PECR HGNCID:18281 Length:303 Species:Homo sapiens

Alignment Length:252 Identity:84/253 (33%)
Similarity:128/253 (51%) Gaps:12/253 (5%)


  Fly     7 KVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVA----AGGAPALQVAADINS 67
            :|.||||.::|||......|.:||..:.|..|.|::|...|:::.|    ...|..:.:..:|.:
Human    19 QVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTKQARVIPIQCNIRN 83

  Fly    68 ESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIK 132
            |.:|..:|.:||...|:|:.||||.|...|...|:.|.:.:..|:.||:...:.:...|....:|
Human    84 EEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMK 148

  Fly   133 TK-GNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVII--TELQR 194
            .. |:|||: .|.....||..:....::|.|...|:.:|||.|..|:|:|.|.||||.  |.::.
Human   149 EHGGSIVNI-IVPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVEN 212

  Fly   195 RGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGGR 251
            .|...|    .|.|.:.......|.|..:||::.:.||.|..|||.||.|:.|||||
Human   213 YGSWGQ----SFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGR 265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 83/251 (33%)
NADB_Rossmann 4..254 CDD:304358 84/253 (33%)
PECRNP_060911.2 TER_DECR_SDR_a 16..267 CDD:187627 84/253 (33%)
Microbody targeting signal 301..303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.