DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and pecr

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001017727.1 Gene:pecr ZFINID:ZDB-GENE-050417-232 Length:299 Species:Danio rerio

Alignment Length:263 Identity:81/264 (31%)
Similarity:130/264 (49%) Gaps:28/264 (11%)


  Fly     4 FKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQ----IVAAGGAPALQVAAD 64
            |..||.:|||..:|||...:..|.:||..:.|..|.|::|...||:    |.::..|....:..:
Zfish    12 FNHKVAVVTGGGTGIGKAITSELLQLGCSVVISSRKLERLKSAAEELTLKIPSSSPAKVTPIECN 76

  Fly    65 INSESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPE 129
            |.:|.:|:.::::||..|||||.||||.|..........|.:.:..|::||:...:.........
Zfish    77 IRNEDEVKNLMASTLKLHGRIDFLVNNGGGQFSSPANMMSAKGWKAVIDTNLNGTFLCCREAYNA 141

  Fly   130 LIKTKGNIVNVSSVNGI----RSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIIT 190
            .:|..|.::    ||.|    :.|||:.....::||||..|:.:|:|.|..|||:|||.||.||:
Zfish   142 WMKDHGGVI----VNIIADMWKGFPGMAHTGAARAAVDNLTKSLAIEWAHSGVRINSVAPGTIIS 202

  Fly   191 ELQRRGGLDQEAYVKFLEHAKVTHALGRP-------GEVKEVAAAIAFLASDEASFSTGISLPVD 248
                     :.|...:.|:......:..|       |..:|::.|:.||.|..|::.||.:|.||
Zfish   203 ---------KTAMENYKEYGPTLFKMSVPFSPAKRLGVPEEISPAVCFLLSPAANYITGATLKVD 258

  Fly   249 GGR 251
            .|:
Zfish   259 AGQ 261

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 81/262 (31%)
NADB_Rossmann 4..254 CDD:304358 81/264 (31%)
pecrNP_001017727.1 fabG 28..263 CDD:235546 72/248 (29%)
TER_DECR_SDR_a 28..263 CDD:187627 72/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.