DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and zgc:101858

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001005597.1 Gene:zgc:101858 ZFINID:ZDB-GENE-040927-13 Length:265 Species:Danio rerio

Alignment Length:255 Identity:167/256 (65%)
Similarity:201/256 (79%) Gaps:0/256 (0%)


  Fly     3 SFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINS 67
            |..|||.::|||||||||||::|.||||..|.:.||:::.|.:.|::..|.|.|..|.||.|:..
Zfish    11 SLNDKVTLITGASSGIGAGTALLFAKLGARLALNGRDVENLTKVAKECEACGAAKPLLVAGDLTD 75

  Fly    68 ESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIK 132
            |..|:..|...:|..||:|||||:||||.:||||.|.:.|:|:||:.||||:|.||||..|.|||
Zfish    76 EETVRRTVEEVIAHFGRLDVLVNSAGILAMGSIETTDMAQYDKVMSVNVRSIYHLTHLCVPHLIK 140

  Fly   133 TKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRRGG 197
            |||:|||||||||.|||||||||.:||:|:||||||||||||.|.||||||.|||||||:.:|.|
Zfish   141 TKGSIVNVSSVNGQRSFPGVLAYCMSKSAIDQFTRCVALELASKQVRVNSVCPGVIITEVHKRAG 205

  Fly   198 LDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGGRHAMCPR 257
            ||:|.|.:|:|..||||||||||||.|||.||||||||.|:|.||::|||||||||||||
Zfish   206 LDEEQYAQFIEKCKVTHALGRPGEVDEVAHAIAFLASDAATFITGVNLPVDGGRHAMCPR 265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 160/248 (65%)
NADB_Rossmann 4..254 CDD:304358 162/250 (65%)
zgc:101858NP_001005597.1 fabG 11..260 CDD:235546 161/249 (65%)
SDR_c11 12..262 CDD:187622 162/250 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C143511913
eggNOG 1 0.900 E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H133865
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D487970at33208
OrthoFinder 1 1.000 FOG0000082
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126618
Panther 1 1.100 O PTHR43975
Phylome 1 0.910 0.875 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.