DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and MGC79752

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001005019.1 Gene:MGC79752 XenbaseID:XB-GENE-5820599 Length:264 Species:Xenopus tropicalis

Alignment Length:255 Identity:165/256 (64%)
Similarity:198/256 (77%) Gaps:0/256 (0%)


  Fly     3 SFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINS 67
            :.||||.:||||||||||||::|.|:||..|.:.|||.:||.|||:......|...|.|..|:..
 Frog    10 NLKDKVCLVTGASSGIGAGTALLFARLGARLALNGRNEEKLQETAQGCEQFSGMKPLLVPGDLTD 74

  Fly    68 ESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIK 132
            |..|:.||..|:|..||:|||||:.|||.:|::|||||:.||||||.|||||:.||||..|.||:
 Frog    75 EESVRKIVEQTVAHFGRLDVLVNSGGILAMGTVENTSLQDFDRVMNVNVRSLFYLTHLAVPHLIQ 139

  Fly   133 TKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRRGG 197
            |||||||||||||.|||||||||.:||:||||.|||.|||||||.||||:|.||||||::.||.|
 Frog   140 TKGNIVNVSSVNGQRSFPGVLAYCMSKSAVDQLTRCAALELAPKQVRVNAVCPGVIITDVHRRAG 204

  Fly   198 LDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGGRHAMCPR 257
            |::|.|.:|::..:.||||||||.|.|||..|||||||.|||.||:::||||||||||||
 Frog   205 LNEEQYSEFIQRTQHTHALGRPGTVDEVAKTIAFLASDAASFITGVTMPVDGGRHAMCPR 264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 158/248 (64%)
NADB_Rossmann 4..254 CDD:304358 161/250 (64%)
MGC79752NP_001005019.1 SDR_c11 11..261 CDD:187622 161/250 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C143512047
eggNOG 1 0.900 E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H133865
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D487970at33208
OrthoFinder 1 1.000 FOG0000082
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.654 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.