DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and decr1

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001076813.1 Gene:decr1 XenbaseID:XB-GENE-985109 Length:337 Species:Xenopus tropicalis

Alignment Length:261 Identity:74/262 (28%)
Similarity:118/262 (45%) Gaps:23/262 (9%)


  Fly     3 SFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINS 67
            |||.||..:||..:|:|.|.:..|::||....|..|.||.|.:||.::.:..|.....|..|:..
 Frog    58 SFKGKVAFITGGGTGLGRGMTTTLSRLGAECVISSRKLDVLKKTAAEVTSETGNKVHPVQCDVRD 122

  Fly    68 ESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIK 132
            ...|:..|...:...|..||::|||....:...|..|...:..:.:..:.....:|..|..||||
 Frog   123 PESVKKAVEELIQVAGHPDVVINNAAGNFISPSERLSANAWKTITDIVLNGTAYVTLEVGKELIK 187

  Fly   133 T-KG----NIVNVSSVNGIRSFPGVLAYNVS-KAAVDQFTRCVALELAPKGVRVNSVNPGVIITE 191
            . ||    :|..|.:.:|    .|.:..:.| ||.|:...:.:|.|....|:|.|.:.||.|.|:
 Frog   188 AGKGAAFLSITTVYANSG----SGFVVPSASAKAGVEVMCKSLASEWGKYGMRFNVIQPGPIRTK 248

  Fly   192 -----LQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGGR 251
                 |...|..:.|...:.        ..||.|.::|:|...::|.||.|::..|..:.:|||.
 Frog   249 GAFSRLDPTGQFEAEMLKRI--------PCGRLGTIEEIANLASYLCSDYATWVNGAIIRLDGGE 305

  Fly   252 H 252
            :
 Frog   306 Y 306

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 74/259 (29%)
NADB_Rossmann 4..254 CDD:304358 73/261 (28%)
decr1NP_001076813.1 TER_DECR_SDR_a 59..305 CDD:187627 73/258 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.