DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and CG31546

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_730973.1 Gene:CG31546 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster

Alignment Length:255 Identity:135/256 (53%)
Similarity:187/256 (73%) Gaps:2/256 (1%)


  Fly     4 FKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSE 68
            |..||:::|||:|||||..:.:.:|||..|.:|.|..:.|....::.:..|..| ..:|.|:...
  Fly    11 FSGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEP-YGIAGDLLKP 74

  Fly    69 SDVQGIVSATLAKH-GRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIK 132
            .:::.|...|..:: |::|||||.|||:..|::::|.|..|..||..||||.:.||.|:.|:|::
  Fly    75 PEIECIARKTTERYEGKLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSGFYLTKLLLPQLLQ 139

  Fly   133 TKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRRGG 197
            .||:|||||||.|:|:||.::|||:||||||||||.:||:|.|:|||||:||||||.|.||:.||
  Fly   140 CKGSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVIRTNLQKAGG 204

  Fly   198 LDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGGRHAMCPR 257
            :|:::|.:||||:|.||||||.||.|||||||.||||:.|||.||::||||||:..||||
  Fly   205 MDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELASFVTGVTLPVDGGKQVMCPR 264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 131/248 (53%)
NADB_Rossmann 4..254 CDD:304358 131/251 (52%)
CG31546NP_730973.1 fabG 9..257 CDD:235975 130/247 (53%)
NADB_Rossmann 11..261 CDD:304358 131/251 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C108569322
eggNOG 1 0.900 E2759_KOG0725
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I1891
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D487970at33208
OrthoFinder 1 1.000 FOG0000082
orthoMCL 1 0.900 OOG5_126618
Panther 1 1.100 P PTHR43975
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.