DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and cbr4

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_991219.2 Gene:cbr4 ZFINID:ZDB-GENE-040426-1796 Length:237 Species:Danio rerio

Alignment Length:244 Identity:83/245 (34%)
Similarity:124/245 (51%) Gaps:14/245 (6%)


  Fly     7 KVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSESDV 71
            ::.:|.|.|.|||...|.|||:.|..:.::.||.:....||:.:   .|...|.::.|::.|.:|
Zfish     3 RLAVVFGGSRGIGRAVSKLLAQRGHRIVLLSRNKEAAQATAQSL---PGENHLGLSCDVSKEEEV 64

  Fly    72 QGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIKTKGN 136
            |..........|.:..|||.|||.....:..:..|....|::||:.............::...|.
Zfish    65 QKAFETINKTCGTVGFLVNAAGINRDALLLRSKSEDMLSVLHTNLLGSMLTCKAAVRNMLSHGGA 129

  Fly   137 IVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRRGGLDQE 201
            |||:.||.|::...|...|:.|||.::.|||.:|.|:|.:.:|||.|.||:|.|::  ..||.:|
Zfish   130 IVNIGSVVGVKGNAGQCVYSASKAGLEGFTRSLAKEVASRNIRVNLVAPGLIHTDM--TAGLAEE 192

  Fly   202 AYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
            |.|:       |..|||.||..|||.|:.||.  |:.:.||..|.||||
Zfish   193 AAVR-------TIPLGRFGEPAEVAQAVLFLL--ESPYITGQILLVDGG 232

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 83/245 (34%)
NADB_Rossmann 4..254 CDD:304358 83/245 (34%)
cbr4NP_991219.2 fabG 1..235 CDD:235546 83/245 (34%)
NADB_Rossmann 3..233 CDD:304358 83/245 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000082
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126618
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1710
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.