DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and decr2

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_002932500.2 Gene:decr2 XenbaseID:XB-GENE-5949565 Length:300 Species:Xenopus tropicalis

Alignment Length:254 Identity:87/255 (34%)
Similarity:127/255 (50%) Gaps:18/255 (7%)


  Fly     5 KDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSES 69
            |.:|..:||..||||...:.:..:.|....||.|||.:::|.||::..|.|...|.::.|:....
 Frog    33 KGRVAFITGGGSGIGFRIAEIFMRHGCDTIIVSRNLQRVSEAAEKLKVATGQRCLPLSGDVRDAQ 97

  Fly    70 DVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIKTK 134
            .:...|...|....|:|:|||||....|....:.||..|..|::.:....:..:.::.....:..
 Frog    98 SMNAAVEEALRIFSRVDILVNNAAGNFLCPASSLSLNAFKTVIDIDTVGTFNASKILFERFFRDN 162

  Fly   135 GN-IVNVSSVNGIRSFPG-VLAYNV--SKAAVDQFTRCVALELAPKGVRVNSVNPGVII-TE-LQ 193
            |. |||:::.   .||.| ||..:.  :|||||..|:.:|:|..|..||||.:.||.:. || ::
 Frog   163 GGVIVNITAT---LSFRGQVLQVHAGSAKAAVDAMTKHLAVEWGPSRVRVNCLAPGPVSGTEGMR 224

  Fly   194 RRGGLDQEAYVKFLEHAKV--THALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
            |.||...||       |.|  |..|.|.|...|:|....||||..|||.||.:|.:|||
 Frog   225 RLGGAAAEA-------AGVWATLPLQRIGNKTEIAHGALFLASPLASFVTGTTLVMDGG 276

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 87/255 (34%)
NADB_Rossmann 4..254 CDD:304358 87/255 (34%)
decr2XP_002932500.2 TER_DECR_SDR_a 32..279 CDD:187627 87/255 (34%)
PRK07576 32..277 CDD:236056 87/255 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.