DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and dhrs4

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_956861.2 Gene:dhrs4 ZFINID:ZDB-GENE-040426-1498 Length:276 Species:Danio rerio

Alignment Length:257 Identity:83/258 (32%)
Similarity:141/258 (55%) Gaps:23/258 (9%)


  Fly     7 KVIIVTGASSGIGAGTSVLLAKLGGLLTIVGR---NLDKLNETAEQIVAAGGAPALQVAADINSE 68
            ||.|||.::.|||...:..|.:.|..:.:..|   |:||    |..::.:.....:....::...
Zfish    31 KVAIVTASTDGIGLAAAEALGQRGAHVVVSSRRQTNVDK----AVSLLRSKNIKVIGTTCNVGKA 91

  Fly    69 SDVQGIVSATLAKHGRIDVLVNNAGILE-LGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIK 132
            .|.:.:::.|:.:.|.:|:||:||.:.. .|:|.:::.|.:|:::..||::.:.||.:|.|.:.|
Zfish    92 EDREKLINMTVEQCGGVDILVSNAAVNPFFGNILDSTEEVWDKILGVNVKASFLLTKMVVPHIEK 156

  Fly   133 T-KGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITEL---- 192
            . .|::|.||||.|.:..|.:..|:|||.|:...||.:|.|||...:|||.|.||:|.|..    
Zfish   157 RGGGSVVIVSSVAGYQPMPALGPYSVSKTALLGLTRALAPELAQSNIRVNCVAPGIIKTRFSSAL 221

  Fly   193 -QRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGGRHA 253
             :..|.|::     ||:...:.. ||:|   :|:...||||.|||||:.||.::.|.||.::
Zfish   222 WENEGVLEE-----FLKQTSIKR-LGQP---EEIGGVIAFLCSDEASYITGETITVTGGMNS 274

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 83/254 (33%)
NADB_Rossmann 4..254 CDD:304358 83/258 (32%)
dhrs4NP_956861.2 CR_SDR_c 21..276 CDD:187641 83/258 (32%)
fabG 28..272 CDD:235975 83/254 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000082
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.