DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and Cbr4

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_872613.1 Gene:Cbr4 RGDID:727826 Length:236 Species:Rattus norvegicus

Alignment Length:246 Identity:88/247 (36%)
Similarity:123/247 (50%) Gaps:17/247 (7%)


  Fly     6 DKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSESD 70
            |||..|.|.|.|||...:.|:|:.|..|.||.|||:....||.::    |...|....:|..|.|
  Rat     2 DKVCAVFGGSRGIGKAVAQLMAQKGYRLAIVARNLEVAKATASEL----GGIHLAFRCNIAKEGD 62

  Fly    71 VQGIVSATLAKH-GRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIKTK 134
            |..... .:.|| |.::.|||.|||.....:..|..|.....::||:.............:|:..
  Rat    63 VHSTFE-EMEKHLGPVNFLVNAAGINRDSLLVRTKTEDMLSQLHTNLLGTMLTCRAAMRTMIQQG 126

  Fly   135 GNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRRGGLD 199
            |:||||.|:.|::...|..||:.:|..:..|:|.:|.|:|.|.:|||.|.||.|.|::.:     
  Rat   127 GSIVNVGSIIGLKGNVGQAAYSATKGGLIGFSRSLAKEVARKKIRVNVVAPGFIHTDMTK----- 186

  Fly   200 QEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
               ::| .||.|....|||.||..|||.|:.||.  |:.:.||..|.||||
  Rat   187 ---HLK-EEHFKKNIPLGRFGEALEVAHAVVFLL--ESPYITGHVLIVDGG 231

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 88/247 (36%)
NADB_Rossmann 4..254 CDD:304358 88/247 (36%)
Cbr4NP_872613.1 fabG 1..234 CDD:235546 88/247 (36%)
NADB_Rossmann 3..232 CDD:304358 87/246 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000082
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126618
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.