DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and CG31548

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_730974.1 Gene:CG31548 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster

Alignment Length:255 Identity:175/256 (68%)
Similarity:205/256 (80%) Gaps:0/256 (0%)


  Fly     3 SFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINS 67
            :|..||:::|||||||||.|::..||.|..|.:.|||::.|.:.|.:......:....|..||..
  Fly     2 NFAGKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVGDIAK 66

  Fly    68 ESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIK 132
            |:|.|.|.|.||.::|::|||||||||:|.|:||.|||||:|||||||:|::|.||.|.||||:|
  Fly    67 EADTQRIWSETLQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPELVK 131

  Fly   133 TKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRRGG 197
            ||||||||||||||||||||||||:||..|||||||||||||.||||||.|||||.:|.|..|||
  Fly   132 TKGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNLHARGG 196

  Fly   198 LDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGGRHAMCPR 257
            :|.|.|.|||||:|.||||||||:|||||||||||||||||||||:||||||||||||||
  Fly   197 MDAETYKKFLEHSKTTHALGRPGDVKEVAAAIAFLASDEASFSTGVSLPVDGGRHAMCPR 256

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 168/248 (68%)
NADB_Rossmann 4..254 CDD:304358 171/250 (68%)
CG31548NP_730974.1 fabG 1..250 CDD:235975 168/248 (68%)
NADB_Rossmann 3..253 CDD:304358 171/250 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C108569425
eggNOG 1 0.900 E2759_KOG0725
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I1891
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D487970at33208
OrthoFinder 1 1.000 FOG0000082
orthoMCL 1 0.900 OOG5_126618
Panther 1 1.100 P PTHR43975
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.