DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and Hsdl2

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001020868.1 Gene:Hsdl2 RGDID:1305387 Length:524 Species:Rattus norvegicus

Alignment Length:206 Identity:59/207 (29%)
Similarity:94/207 (45%) Gaps:14/207 (7%)


  Fly     9 IIVTGASSGIGAGTSVLLAKLGGLLTIVGRN-------LDKLNETAEQIVAAGGAPALQVAADIN 66
            :.:||||.|||...::..||.|..:.|..:.       |..:...||:|.|||| .||....|:.
  Rat    13 VFITGASRGIGKAIALKAAKDGANIVIAAKTTQRHPKLLGTIYTAAEEIEAAGG-KALPCVVDVR 76

  Fly    67 SESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELI 131
            .|..:...|...:.:.|.||:|||||..:.|.:...|..::.|.:|:.|.|..|..:....|.|.
  Rat    77 DEQQINSAVEKAVERFGGIDILVNNASAISLTNTLETPTKRVDLMMSVNTRGTYLTSKACIPFLK 141

  Fly   132 KTK-GNIVNVSSVNGIRS--FPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVII--TE 191
            |:| .:|:|:|....:..  |....||.::|..:......:|.|...: :.||::.|...|  ..
  Rat   142 KSKVAHILNLSPPLNLNPMWFKQHCAYTIAKYGMSMCVLGMAEEFRGE-IAVNALWPRTAIHTAA 205

  Fly   192 LQRRGGLDQEA 202
            :...||...|:
  Rat   206 MDMLGGAGVES 216

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 59/207 (29%)
NADB_Rossmann 4..254 CDD:304358 59/207 (29%)
Hsdl2NP_001020868.1 HSDL2_SDR_c 8..248 CDD:187663 59/207 (29%)
adh_short 12..197 CDD:278532 54/186 (29%)
SCP2 424..517 CDD:280250
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.