DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and CG3699

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_569875.2 Gene:CG3699 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster

Alignment Length:255 Identity:137/256 (54%)
Similarity:177/256 (69%) Gaps:5/256 (2%)


  Fly     3 SFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINS 67
            |..:||:|||||||||||..:.:||:.|..|.:||||:..|..|.:.:   .|..|..|.||:..
  Fly     2 SLSNKVVIVTGASSGIGAAIAQVLAREGATLALVGRNVANLEATKKSL---KGTQAEIVVADVTK 63

  Fly    68 ESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIK 132
            ::|  .||..||||.|||||||||||||..|.:.:..:|:||.|:|||:|.:..||..|.|.|:|
  Fly    64 DAD--AIVQQTLAKFGRIDVLVNNAGILGKGGLIDLDIEEFDAVLNTNLRGVILLTKAVLPHLLK 126

  Fly   133 TKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRRGG 197
            |||.:|||||..|||.|.|.|:|.|||||:||||:.||||:||:||||||||||.::|.:.|..|
  Fly   127 TKGAVVNVSSCAGIRPFAGALSYGVSKAALDQFTKIVALEMAPQGVRVNSVNPGFVVTNIHRNIG 191

  Fly   198 LDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGGRHAMCPR 257
            :..|.|...|:.|..:|.:||.|:|.|||.|:|||||.:|||:||...|:|||:|.:.||
  Fly   192 IVDEEYNGMLQRAINSHPMGRVGDVTEVAEAVAFLASSKASFTTGALFPIDGGKHNLTPR 251

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 134/248 (54%)
NADB_Rossmann 4..254 CDD:304358 134/250 (54%)
CG3699NP_569875.2 fabG 1..244 CDD:235546 133/247 (54%)
NADB_Rossmann 3..248 CDD:304358 134/250 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C143514975
eggNOG 1 0.900 E2759_KOG0725
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I1891
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D487970at33208
OrthoFinder 1 1.000 FOG0000082
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43975
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1710
77.020

Return to query results.
Submit another query.