DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and SPAC922.06

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_595006.1 Gene:SPAC922.06 PomBaseID:SPAC922.06 Length:258 Species:Schizosaccharomyces pombe

Alignment Length:252 Identity:78/253 (31%)
Similarity:127/253 (50%) Gaps:28/253 (11%)


  Fly     7 KVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSESDV 71
            :|:::|||:.|||.....:..:||..:.    .:|.::.:..|      ..||.:.||::....:
pombe     6 RVVLITGAAGGIGKVLCKMFTELGDRVA----GIDIVDPSKVQ------DAALALQADVSKADQI 60

  Fly    72 QGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIK--TK 134
            :..:...:...|.||||:||||:.:....|..|.|.:|..::..:|..|.....|.|.:.|  ..
pombe    61 ETAIEKVIQTLGPIDVLINNAGLADDTPFEQLSHESWDHDVSLVLRGNYLTQRYVIPHMAKQGKG 125

  Fly   135 GNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRRGGLD 199
            |:|||:.|||| ..:.|..||:.:||.::..|:.:|:...|.|:|||...||.|.:.     ..|
pombe   126 GSIVNIGSVNG-HIYLGSPAYSAAKAGLENLTKALAVRYGPLGIRVNVCAPGTIWSP-----AWD 184

  Fly   200 QEAYVKFLEHAKV------THALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
            :    :|.:|..|      .:.:||.|..::||.|:.|||..:.||.||.:|.||||
pombe   185 E----RFKKHPDVGDRMKRWYPVGRLGTPEDVARAVIFLADSKNSFITGTTLYVDGG 237

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 78/253 (31%)
NADB_Rossmann 4..254 CDD:304358 78/253 (31%)
SPAC922.06NP_595006.1 PRK07074 6..248 CDD:180823 78/253 (31%)
SDR_c 8..235 CDD:212491 74/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000082
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1710
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.