DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and oar2

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_594074.1 Gene:oar2 PomBaseID:SPAC3G9.02 Length:236 Species:Schizosaccharomyces pombe

Alignment Length:247 Identity:74/248 (30%)
Similarity:129/248 (52%) Gaps:20/248 (8%)


  Fly     9 IIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINSESDVQG 73
            :::||.|||:|...:.:.::.|....|||||...|.||.:.:..|.|.......||:  :||::.
pombe     4 VLITGGSSGLGKRIAQIWSQKGHQCHIVGRNEFHLKETLQSLSVAKGQQHTLTIADV--QSDMKN 66

  Fly    74 IVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIKTKGN-- 136
            :.|  :.:...||.:|:.||:|:......||.::.|.::.||:.|..:|:.:...|..:.|.:  
pombe    67 LKS--IFESVEIDTVVHAAGVLQSSLCVRTSEKEIDSIICTNLVSAIKLSKMAILEWFRNKNSER 129

  Fly   137 ---IVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRRGGL 198
               |:|:||.....:.||...|..|||.::.||:.:|.|:|.||:|||:::||.:.|.:      
pombe   130 DRLILNISSRLSTYALPGTSVYAASKAGLESFTKVLAAEVASKGIRVNAISPGYVDTPM------ 188

  Fly   199 DQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
             ..:.::.:...||  .:||.....|:..|..||..:.  ::||..||:.||
pombe   189 -LSSQIRAIAEKKV--PIGRLASTDEIVDACTFLLDNR--YTTGTILPITGG 235

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 74/248 (30%)
NADB_Rossmann 4..254 CDD:304358 74/248 (30%)
oar2NP_594074.1 FabG 1..236 CDD:223959 74/248 (30%)
SDR_c 4..233 CDD:212491 72/244 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I1414
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000082
OrthoInspector 1 1.000 T631605
orthoMCL 1 0.900 OOG5_126618
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1710
TreeFam 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.