DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and SPAC8E11.10

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_594161.1 Gene:SPAC8E11.10 PomBaseID:SPAC8E11.10 Length:255 Species:Schizosaccharomyces pombe

Alignment Length:269 Identity:89/270 (33%)
Similarity:131/270 (49%) Gaps:29/270 (11%)


  Fly     1 MPSFKDKVIIVTGASSGIGAGTSVLLAKLG---GLLTIVGRNLDKLNETAEQIVAAGGAPALQVA 62
            |.|.|.|..::||.|.|||...:...|..|   |||  .||| .|..|.|.::....|..|...:
pombe     4 MFSLKGKTTLITGGSGGIGFSIAKAFAAAGSNVGLL--YGRN-KKALEYAAELRDKHGVQAKAYS 65

  Fly    63 ADINSESDVQGIVSATLAK-HGRIDVLVNNAGILELGSIENTSLEQ-----FDRVMNTNVRSLYQ 121
            ..|.:.|.|....:..:.: .||:||::.||||    :|.:.|||.     :.:|:..|:...|.
pombe    66 CPIENRSAVIETTNQAVEELGGRLDVMIANAGI----AIPHLSLEDKNEDIWTKVVGINLNGAYY 126

  Fly   122 LTHLVTPELIKT-KGNIVNVSSVNG-IRSFPGVLA-YNVSKAAVDQFTRCVALELAPKGVRVNSV 183
            ..........|. ||:::..:|::| |.::|...| |:.:||||....|.:|:|.|| ..|||||
pombe   127 TAQAAGHHFKKQGKGSLIFTASMSGHIANWPQQWASYHATKAAVKHLARALAVEWAP-FARVNSV 190

  Fly   184 NPGVIITELQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVD 248
            :||.|.|:|....  |:....|:.|:..... :|.|   .|:..|..:||||.:|:.||..:.||
pombe   191 SPGYIDTDLTLYA--DENLRKKWKEYTPQAR-IGLP---DELPGAYLYLASDASSYCTGSDIIVD 249

  Fly   249 GGRHAMCPR 257
            ||   .|.|
pombe   250 GG---YCSR 255

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 86/261 (33%)
NADB_Rossmann 4..254 CDD:304358 85/262 (32%)
SPAC8E11.10NP_594161.1 PRK05867 1..252 CDD:135631 87/265 (33%)
MDH-like_SDR_c 2..254 CDD:187610 88/267 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.