DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and SPAC22A12.17c

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_593247.1 Gene:SPAC22A12.17c PomBaseID:SPAC22A12.17c Length:261 Species:Schizosaccharomyces pombe

Alignment Length:259 Identity:78/260 (30%)
Similarity:121/260 (47%) Gaps:30/260 (12%)


  Fly     3 SFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINS 67
            |.|.|..:|.|.:.|||.....:.|:.|....|| .|.....:.|::|..|.|........|:..
pombe    18 SLKGKNAVVFGGARGIGHAICSVFAEAGANAFIV-YNTTPGEKAAKEIAQANGVKTYTCKCDVTI 81

  Fly    68 ESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIK 132
            ..:|:...:........||::|.|.||....|..:.:.|:|...:|.|:..::.:.|...|...|
pombe    82 PKEVEHAFAEIQKVFDTIDIVVPNNGICTGKSAIDMTYEEFANEINVNLLGVFNVAHNAGPIFQK 146

  Fly   133 T-KGNIVNVSSVNGIRSFPGVL-------AYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVII 189
            . .|::|..:|::|:     |:       |||.|||.|.|..:.:|:|.. |..|||.|:||...
pombe   147 QGHGSLVATASMSGV-----VVNVPQQQCAYNTSKAGVIQLIKSLAVEWR-KFARVNCVSPGYTT 205

  Fly   190 TELQRRGG---LDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
            :::  .||   .:.|.|..|          .|.|..||:|:|..:||||.||:::|.:|.||||
pombe   206 SDM--TGGKFHKEWEPYTPF----------ERNGLAKEIASAYLYLASDAASYASGTNLIVDGG 257

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 78/260 (30%)
NADB_Rossmann 4..254 CDD:304358 77/259 (30%)
SPAC22A12.17cNP_593247.1 MDH-like_SDR_c 14..260 CDD:187610 78/260 (30%)
fabG 18..257 CDD:235500 77/258 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.