DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and SPBC30D10.05c

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_596280.1 Gene:SPBC30D10.05c PomBaseID:SPBC30D10.05c Length:247 Species:Schizosaccharomyces pombe

Alignment Length:249 Identity:74/250 (30%)
Similarity:122/250 (49%) Gaps:18/250 (7%)


  Fly     1 MPSFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADI 65
            |....:|||::||:|.|||..|:..|.|...::. |.|:|....||   ::.......:.|..|:
pombe     1 MAETAEKVILLTGSSKGIGLATAEALQKKAKVIA-VSRSLTPELET---LLIQNPDSFVHVKGDV 61

  Fly    66 NSESDVQGIVSATLAKHGRIDVLVNNAGILE-LGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPE 129
            ....  :..:...:.|.|::|.::.|||:|| :..|.:..:.::.::.:.|..|:.:......|.
pombe    62 TEVG--KASIETAIKKFGKLDSVILNAGVLEPIAKIADADINEWRKLFDINFFSVVETVKYAIPH 124

  Fly   130 LIKTKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQ- 193
            |.||||.||.|||...:|.||...||..||||::.....:..| .|..:.| :|.|||:.|.:| 
pombe   125 LRKTKGTIVIVSSGAAVRVFPAWAAYCCSKAAINMLVMNLGSE-EPDIMSV-AVRPGVVDTPMQV 187

  Fly   194 -RRGGLDQEAY----VKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTG 242
             .|...::||.    ..|.:..|.:..|..|   :::|.|::|||.:.....||
pombe   188 SIRNDSNKEAMGGDTHNFFKELKTSGQLVAP---QDIAKALSFLALNNNPKLTG 238

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 73/249 (29%)
NADB_Rossmann 4..254 CDD:304358 73/247 (30%)
SPBC30D10.05cNP_596280.1 adh_short 7..190 CDD:278532 59/191 (31%)
SPR-like_SDR_c 8..245 CDD:187625 72/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1710
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.