DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and SPCC1739.08c

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_588416.1 Gene:SPCC1739.08c PomBaseID:SPCC1739.08c Length:261 Species:Schizosaccharomyces pombe

Alignment Length:253 Identity:78/254 (31%)
Similarity:126/254 (50%) Gaps:18/254 (7%)


  Fly     3 SFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADINS 67
            |.|.|..:|.||:.|||...:...|:.||.:.|.....|. .|.|:::....|.....:..||:.
pombe    18 SLKGKNCVVFGAAKGIGFSIATAFAQAGGNVIITYLTTDP-TEKAKKLAEETGVQVHTLKIDISR 81

  Fly    68 ESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIK 132
            ...|:..|.........|.|:|.|||:....|:.::...:|::|||.|..|:|::.:.: .::.|
pombe    82 SDTVEAGVEEIQKIFKEIHVVVANAGMPFRRSVLDSPPHEFEKVMNINTNSVYRVAYYM-GKIFK 145

  Fly   133 TK--GNIVNVSSVNG--IRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQ 193
            .:  ||::..:|::.  :.:...:.||..|||||.|..:.:|:|.| :..|:|||:||...|::.
pombe   146 KQGFGNLIATASMSATIVNAPQHIAAYCASKAAVRQLCKALAVEWA-EFARINSVSPGYFATDMP 209

  Fly   194 RRGGLDQ-EAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250
            ....|.| |.||.|          .|.|...|:.....:|||:.:||.||:.|.||||
pombe   210 GYEFLKQWEPYVPF----------KRLGLTPELRGTYLYLASNASSFVTGLDLIVDGG 257

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 78/254 (31%)
NADB_Rossmann 4..254 CDD:304358 77/253 (30%)
SPCC1739.08cNP_588416.1 PRK05867 13..260 CDD:135631 78/254 (31%)
MDH-like_SDR_c 14..260 CDD:187610 78/254 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1710
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.