DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and ZK829.1

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_502263.1 Gene:ZK829.1 WormBaseID:WBGene00014093 Length:284 Species:Caenorhabditis elegans

Alignment Length:277 Identity:99/278 (36%)
Similarity:143/278 (51%) Gaps:29/278 (10%)


  Fly     1 MPS--FKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAP--ALQV 61
            ||.  |..||::::|:|.|||..|:|..|..|..:.:.||:.|.:.:|.:..:..|..|  .|..
 Worm     1 MPGTRFSGKVVLISGSSKGIGQATAVKFAAEGAKIVLNGRSADDVEKTRKLCMEVGAKPWDLLPT 65

  Fly    62 AADINSESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQ----FDRVMNTNVRSLYQL 122
            ..||.:|..|:.:|:..:...|::|:|:||||.||:........|.    .||..|:|.:|:..|
 Worm    66 VGDITNEDFVKMMVNTVIHNFGKLDILINNAGTLEVDMTGKEGWEMGVDVMDRSWNSNFKSVLML 130

  Fly   123 THLVTPELIKTKGNIVNVSSV-----NGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNS 182
            |....|.||||||:|||||:.     .|:.|.|   .|.|.|||:||.:|.:|.|...||||:|:
 Worm   131 TQAAMPHLIKTKGDIVNVSTFLSSGPIGVMSMP---YYAVPKAALDQMSRSMAHEYMLKGVRLNT 192

  Fly   183 VNPGVIITELQRR-------GGLDQEAYVKFLEHAKVTH-ALGRPGEVKEVAAAIAFLASDEAS- 238
            ||||::.|....|       .....|.||:    :|..: .|||..:..:||..|.|||..:.| 
 Worm   193 VNPGLVSTSFFARLPGVGDDNARKMENYVQ----SKTEYIPLGRVCQASDVAETILFLADRKVSE 253

  Fly   239 FSTGISLPVDGGRHAMC 255
            ...|.|:.:|||....|
 Worm   254 CIVGQSIIIDGGSRLCC 270

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 97/271 (36%)
NADB_Rossmann 4..254 CDD:304358 96/270 (36%)
ZK829.1NP_502263.1 FabG 5..265 CDD:223959 95/267 (36%)
NADB_Rossmann 6..268 CDD:304358 96/269 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D487970at33208
OrthoFinder 1 1.000 FOG0000082
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.