DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and T01G6.1

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_503222.1 Gene:T01G6.1 WormBaseID:WBGene00020151 Length:279 Species:Caenorhabditis elegans

Alignment Length:269 Identity:98/270 (36%)
Similarity:152/270 (56%) Gaps:17/270 (6%)


  Fly     1 MPSFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQVAADI 65
            |..|..|.:|:||:|||||..|:||.||.|..:||.|||.:||..|.::::.....|. .|...:
 Worm     1 MTRFAGKSVIITGSSSGIGRATAVLFAKNGAQVTITGRNAEKLEATKKKLLKVVKTPD-SVNVVV 64

  Fly    66 NSESDVQG---IVSATLAKHGRIDVLVNNAGILELGSIENT--SLEQFDRVMNTNVRSLYQLTHL 125
            .:.:|.||   |:.:.:.|.|:||:|:||||...:....||  |::.:.:....|.:::.::...
 Worm    65 ANLTDAQGQDQIIQSAVKKFGKIDILINNAGANVVDGTVNTDQSIDLYHKTFQINFQAVVEMVKK 129

  Fly   126 VTPELIKTKGNIVNVSSVNGIRSFPGVLA----YNVSKAAVDQFTRCVALELAPKGVRVNSVNPG 186
            ....||::||.||||||   |.:.|..::    |..:|||::|:||||||:|..:|||||||:||
 Worm   130 TKKYLIESKGEIVNVSS---IAAGPQAVSMSPYYAAAKAALNQYTRCVALDLIKQGVRVNSVSPG 191

  Fly   187 VIITELQRRGGLDQEAYVKFLE---HAKVTHALGRPGEVKEVAAAIAFLASDEASF-STGISLPV 247
            :|.|......|:.::|..|.:.   ..|.....|.||:.:::|..|.||:..:.|| ..|.|:..
 Worm   192 IIATNFMGAMGVPEQAQKKIVNLFASEKGCIPAGVPGKPEDIAELIVFLSDRKRSFYIVGQSIVA 256

  Fly   248 DGGRHAMCP 256
            |||...:.|
 Worm   257 DGGTSLISP 265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 96/262 (37%)
NADB_Rossmann 4..254 CDD:304358 96/263 (37%)
T01G6.1NP_503222.1 FabG 3..259 CDD:223959 95/260 (37%)
NADB_Rossmann 4..263 CDD:304358 96/263 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000082
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.