DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and F59E11.2

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_505327.2 Gene:F59E11.2 WormBaseID:WBGene00019109 Length:321 Species:Caenorhabditis elegans

Alignment Length:283 Identity:79/284 (28%)
Similarity:135/284 (48%) Gaps:36/284 (13%)


  Fly     5 KDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGR----------NLDKLNETAEQIVAAGGAPAL 59
            :|:|.:|||||.|||.|.::.|.:.|..:.|.||          .|..|:..|::|.:.|| ..:
 Worm     6 QDQVALVTGASRGIGRGIALQLGEAGATVYITGRRPELSDNFRLGLPSLDYVAKEITSRGG-KGI 69

  Fly    60 QVAADINSESDVQGIVSATLA-KHGRIDVLVNNAGILELGS----IENTSLEQ----FDRVMNTN 115
            .:..|.::.::|:.:...... :.|::|:||||. ...||.    |..|..:|    :|.:....
 Worm    70 ALYVDHSNMTEVKFLFEKIKEDEEGKLDILVNNV-YNSLGKATEMIGKTFFDQDPSFWDDINGVG 133

  Fly   116 VRSLYQLTHLVTPELI-KTKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVR 179
            :|:.|..:......:: :.||.||||.|:.|::....| ||...|.|:.:.:..:|:||.|..|.
 Worm   134 LRNHYYCSVYAARMMVERRKGLIVNVGSLGGLKYVFNV-AYGAGKEALARMSTDMAVELNPYNVC 197

  Fly   180 VNSVNPGVIITELQRRGGLDQEAYVKFLEHAKVTHALGRPGEVKE-VAAAIAFLASD-------- 235
            |.::.||.:.||...|..:| :||....|:.::...:  .||..| ...|:|.||.|        
 Worm   198 VVTLIPGPVKTETANRTIID-DAYKMIKENPELEEFI--KGESTEYTGKALARLAMDPGKLKKSG 259

  Fly   236 EASFSTGISLPVD-GGRHAMCPR 257
            :..|:..::...| ..:|.|.|:
 Worm   260 KTLFTEDLAQKYDFSDKHGMEPQ 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 76/276 (28%)
NADB_Rossmann 4..254 CDD:304358 77/279 (28%)
F59E11.2NP_505327.2 PRK08303 5..281 CDD:236229 78/281 (28%)
NADB_Rossmann 5..278 CDD:304358 77/278 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S2936
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.850

Return to query results.
Submit another query.