DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and F02C12.2

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_510229.1 Gene:F02C12.2 WormBaseID:WBGene00008516 Length:278 Species:Caenorhabditis elegans

Alignment Length:263 Identity:103/264 (39%)
Similarity:157/264 (59%) Gaps:13/264 (5%)


  Fly     1 MPS-FKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAG--GAPALQVA 62
            ||. |..||.|:||:|||||..|::|.||.|..:|:.||:.:||.||.:.::.||  .:..|.|.
 Worm     1 MPKRFSKKVAIITGSSSGIGRETALLFAKEGAKVTVTGRSEEKLEETKKALLDAGIKESNFLIVP 65

  Fly    63 ADINSESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQ----FDRVMNTNVRSLYQLT 123
            |||...:....::|.||.|.|||::||||||.....:.:.|.::|    :::||..||:|:.::|
 Worm    66 ADITFSTGQDELISQTLKKFGRINILVNNAGASIPDAKKRTGIDQGIETYEQVMKLNVQSVIEMT 130

  Fly   124 HLVTPELIKTKGNIVNVSSVNGIRS-FPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGV 187
            ..|.|.|.|::|.|||||||..::: :.....|.::|||:||:||..|:.|..:|:|||:||||:
 Worm   131 QKVRPHLAKSRGEIVNVSSVVALKAGWTRTPYYPLAKAALDQYTRSAAIALISEGIRVNTVNPGI 195

  Fly   188 IITELQRR--GGLDQEAYVKFLEHAKVTHAL--GRPGEVKEVAAAIAFLASDEAS-FSTGISLPV 247
            :.|..|..  |....:|...:.:....|.|:  |..|..:.:|.||||||...:| :..|.::..
 Worm   196 VQTGFQANASGSSSDDAQKFYDDMGSNTTAIPCGFAGRPEHIAKAIAFLADRNSSEYIVGQNIIA 260

  Fly   248 DGG 250
            |||
 Worm   261 DGG 263

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 102/263 (39%)
NADB_Rossmann 4..254 CDD:304358 101/260 (39%)
F02C12.2NP_510229.1 FabG 4..263 CDD:223959 100/259 (39%)
NADB_Rossmann 5..267 CDD:304358 101/260 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000082
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.