DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and D1054.8

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_505755.1 Gene:D1054.8 WormBaseID:WBGene00008375 Length:278 Species:Caenorhabditis elegans

Alignment Length:264 Identity:105/265 (40%)
Similarity:159/265 (60%) Gaps:17/265 (6%)


  Fly     1 MPSFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAP--ALQVAA 63
            |..|.:||.|:||:|:|||..|:||.|:.|..:||.||:.::|.||.:||:|||.:.  ...|.|
 Worm     1 MTRFAEKVAIITGSSNGIGRATAVLFAREGAKVTITGRHAERLEETRQQILAAGVSEQNVNSVVA 65

  Fly    64 DINSESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENT----SLEQFDRVMNTNVRSLYQLTH 124
            |:.:::....|:|.||.|.|::|:||||||.....|...|    |:|.:|..:|.|:||:..||.
 Worm    66 DVTTDAGQDEILSTTLGKFGKLDILVNNAGAAIPDSQSKTGTAQSIESYDATLNLNLRSVIALTK 130

  Fly   125 LVTPELIKTKGNIVNVSSV-NGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVI 188
            ...|.|..|||.|||:||: :|:.:.|....|:::|||:||:||..|::|...|:||||::||::
 Worm   131 KAVPHLSSTKGEIVNISSIASGLHATPDFPYYSIAKAAIDQYTRNTAIDLIQHGIRVNSISPGLV 195

  Fly   189 ITELQRRGGLDQEAYVKF------LEHAKVTHALGRPGEVKEVAAAIAFLASDE-ASFSTGISLP 246
            .|......|:.:|...||      ::.......:|:|.::.||   |||||..: :|:..|..|.
 Worm   196 ATGFGSAMGMPEETSKKFYSTMATMKECVPAGVMGQPQDIAEV---IAFLADRKTSSYIIGHQLV 257

  Fly   247 VDGG 250
            ||||
 Worm   258 VDGG 261

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 104/264 (39%)
NADB_Rossmann 4..254 CDD:304358 104/262 (40%)
D1054.8NP_505755.1 FabG 3..261 CDD:223959 103/261 (39%)
SDR_c11 4..265 CDD:187622 104/262 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D487970at33208
OrthoFinder 1 1.000 FOG0000082
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1710
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.