DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and dhs-23

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_506820.1 Gene:dhs-23 WormBaseID:WBGene00000986 Length:277 Species:Caenorhabditis elegans

Alignment Length:260 Identity:110/261 (42%)
Similarity:151/261 (58%) Gaps:11/261 (4%)


  Fly     1 MPSFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQ---VA 62
            |..|..|.||:||:|||||...:|:.||.|..:||.||:.|:|.||..||:.| |.||.:   |.
 Worm     1 MARFSGKSIIITGSSSGIGRSAAVIFAKEGAQVTITGRSADRLEETRLQILKA-GVPAEKINAVV 64

  Fly    63 ADINSESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENT--SLEQFDRVMNTNVRSLYQLTHL 125
            ||:...|....::..||||.|:||:||||||.|......||  ::|.:.:....|.:::.::|..
 Worm    65 ADVCEASGQDEVIRTTLAKFGKIDILVNNAGALLTDGTSNTDQAVELYQKTFKLNFQAVVEMTQK 129

  Fly   126 VTPELIKTKGNIVNVSS-VNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVII 189
            ....||||||.|||||| |.|.::.|....|..:|||:||:|||.|::|...|||||||:||||.
 Worm   130 TKEYLIKTKGEIVNVSSIVAGPQAQPASPYYACAKAALDQYTRCTAIDLIQHGVRVNSVSPGVIA 194

  Fly   190 TELQRRGGLDQEA---YVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDE-ASFSTGISLPVDGG 250
            |......||.:.|   :..|:...|....:|..|:.:|:|..|.|||... :|:..|.|:..|||
 Worm   195 TGFLGAMGLPETASDKFYNFMGSQKECIPVGHCGKPEEIANIIVFLADRRLSSYIIGQSIVADGG 259

  Fly   251  250
             Worm   260  259

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 109/260 (42%)
NADB_Rossmann 4..254 CDD:304358 109/258 (42%)
dhs-23NP_506820.1 FabG 3..259 CDD:223959 108/257 (42%)
SDR_c11 4..263 CDD:187622 109/258 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D913128at2759
OrthoFinder 1 1.000 FOG0000082
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.