DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and dhs-13

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_503501.1 Gene:dhs-13 WormBaseID:WBGene00000976 Length:257 Species:Caenorhabditis elegans

Alignment Length:255 Identity:81/256 (32%)
Similarity:136/256 (53%) Gaps:17/256 (7%)


  Fly     6 DKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETA-----EQIVAAGGAPALQVAADI 65
            |:|.:||.::.|||...:..|...|..:.:..|..:.::|..     |.|.|.|      ..|.:
 Worm    11 DRVALVTASTKGIGFAIAKQLGAAGASVVVCSRKKENVDEAVAALRLENIDAHG------TTAHV 69

  Fly    66 NSESDVQGIVSATLAKHGRIDVLVNNAGI-LELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPE 129
            .::||...::..||.:..::|:||:||.: ...|.:...:..|:|::::.||:|.::||....|.
 Worm    70 GNKSDRTKLIDFTLDRFTKLDILVSNAAVNPHYGDLMKVTDSQWDKLLDLNVKSAFELTKEAVPH 134

  Fly   130 L-IKTKGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQ 193
            | ...:||:|.||||.|......:.||:|.|..:...::.:||.||.:.:||||:.||:|.|:..
 Worm   135 LEASGRGNVVFVSSVAGYSPMNEIGAYSVMKTTLTGLSKSLALNLARRNIRVNSIAPGIIQTDFS 199

  Fly   194 RRGGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGGRHA 253
            :....|:....|:|...    |..|.|:..|.|.|:|||.|||||:.:|.::.::||.||
 Worm   200 QVLFSDESEKQKWLSQI----AQRRFGDPDECAEAVAFLVSDEASYISGETIGINGGMHA 255

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 79/252 (31%)
NADB_Rossmann 4..254 CDD:304358 81/256 (32%)
dhs-13NP_503501.1 NADB_Rossmann 9..257 CDD:304358 81/256 (32%)
fabG 9..253 CDD:235975 79/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000082
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.