DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and Y47G6A.22

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001021765.1 Gene:Y47G6A.22 WormBaseID:WBGene00021647 Length:254 Species:Caenorhabditis elegans

Alignment Length:252 Identity:137/253 (54%)
Similarity:174/253 (69%) Gaps:2/253 (1%)


  Fly     8 VIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGG--APALQVAADINSESD 70
            |.||||||||||...::|||:....|::.|||:..|||.|.|||:||.  ...|..|.::.||..
 Worm     3 VAIVTGASSGIGRAAALLLARNNYKLSLTGRNVAALNELAGQIVSAGSDKNDVLVTAVELASEEA 67

  Fly    71 VQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIKTKG 135
            .:.||.||:.|.||||.|:|:||||..|.:.::.:|.:|.:||.|||||.:||....|.:|.|||
 Worm    68 PKTIVDATVQKFGRIDTLINSAGILRAGPVLDSGIEVYDELMNVNVRSLIRLTRAALPHIITTKG 132

  Fly   136 NIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRRGGLDQ 200
            .:|||||:||...||.|..|.:||:||||||:|:|||:||.|||||:|.|||.:|.|.|..|.|:
 Worm   133 TVVNVSSINGPCPFPNVTYYCMSKSAVDQFTKCLALEMAPNGVRVNAVCPGVTVTNLHRTSGQDE 197

  Fly   201 EAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGGRHAMCPR 257
            ..|..|||.:|.||||||||:..|||.||.||||:::||:||..|.|||||..|.||
 Worm   198 TTYSAFLERSKTTHALGRPGDANEVAEAIYFLASEKSSFTTGELLRVDGGRGIMHPR 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 133/245 (54%)
NADB_Rossmann 4..254 CDD:304358 134/248 (54%)
Y47G6A.22NP_001021765.1 NADB_Rossmann 3..251 CDD:304358 134/248 (54%)
fabG 3..247 CDD:235506 132/244 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0725
Hieranoid 1 1.000
Homologene 1 1.000 H133865
Inparanoid 1 1.050 254 1.000 Inparanoid score I1943
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D487970at33208
OrthoFinder 1 1.000 FOG0000082
OrthoInspector 1 1.000 T97959
orthoMCL 1 0.900 OOG5_126618
Panther 1 1.100 O PTHR43975
Phylome 1 0.910 0.831 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1710
TreeFam 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.