DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12171 and Y47G6A.21

Sequence 1:NP_649563.1 Gene:CG12171 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001021764.1 Gene:Y47G6A.21 WormBaseID:WBGene00021646 Length:255 Species:Caenorhabditis elegans

Alignment Length:253 Identity:133/254 (52%)
Similarity:173/254 (68%) Gaps:3/254 (1%)


  Fly     8 VIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPA---LQVAADINSES 69
            |.|:||||||||.||::|.||....|::.|||.|.|.|.|...::.|...|   |..|.:::|:.
 Worm     3 VAIITGASSGIGKGTALLFAKKKYQLSLTGRNTDSLKEVAALCISEGAISADDILITAVELSSDE 67

  Fly    70 DVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELIKTK 134
            ..:.||.||:.|.||||.|:|:||||..|.:.::.:|.:|.:||.|||||.:||....|.:|.||
 Worm    68 APKAIVDATVQKFGRIDSLINSAGILRAGPVLDSGIEVYDELMNVNVRSLIRLTRAALPHIITTK 132

  Fly   135 GNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRRGGLD 199
            |.:|||||:||...|.||..|.:||:||||||:|:|||:||.|||||:|.||||:|.:.|..|.|
 Worm   133 GTVVNVSSINGPCPFAGVTYYCMSKSAVDQFTKCLALEMAPNGVRVNAVCPGVIVTNIHRASGQD 197

  Fly   200 QEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGGRHAMCPR 257
            :..|..|||.:|.||||||||...|||.||.||:|:::||:||..|.|||||..|.||
 Worm   198 EATYAAFLEKSKTTHALGRPGTTSEVAEAILFLSSEKSSFTTGQLLKVDGGRGIMHPR 255

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12171NP_649563.1 fabG 2..251 CDD:235975 129/246 (52%)
NADB_Rossmann 4..254 CDD:304358 130/249 (52%)
Y47G6A.21NP_001021764.1 FabG 1..249 CDD:223959 129/246 (52%)
NADB_Rossmann 3..252 CDD:304358 130/249 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0725
Hieranoid 1 1.000
Homologene 1 1.000 H133865
Inparanoid 1 1.050 254 1.000 Inparanoid score I1943
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D487970at33208
OrthoFinder 1 1.000 FOG0000082
OrthoInspector 1 1.000 T97959
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43975
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1710
TreeFam 00.000 Not matched by this tool.
1111.010

Return to query results.
Submit another query.